Loading...
Statistics
Advertisement

Whey In On The Curd
www.wheyinonthecurds.com/

Wheyinonthecurds.com

Advertisement
Wheyinonthecurds.com is hosted in United States / San Francisco . Wheyinonthecurds.com uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Wheyinonthecurds.com

Technology

Number of occurences: 9
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Wheyinonthecurds.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 297595277161820265874349418054836283398813
    • validFrom: 160404130800Z
    • validTo: 160703130800Z
    • validFrom_time_t: 1459775280
    • validTo_time_t: 1467551280
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: ED:4E:EE:D6:E8:26:D4:AA:ED:70:52:76:0F:DE:02:20:99:C7:38:B6
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:tls.automattic.com, DNS:whetstoneandassociates.com, DNS:whetstoneathletics.com, DNS:whetyourwanderlust.com, DNS:whetyourwoman.com, DNS:whetzgood.com, DNS:whey-protein-info.com, DNS:wheyinonthecurds.com, DNS:wheymouthbohemian.com, DNS:whf-pa.org, DNS:whfarmacy.com, DNS:whgoftampa.com, DNS:whhealthandfitness.com, DNS:whichcraftandwhimsy.com, DNS:whichdigitalblog.com, DNS:whichhalfoftheglass.com, DNS:whichmitch.com, DNS:whichonesam.com, DNS:whichsailboat.com, DNS:whichshoestoday.com, DNS:whichwayisup.me, DNS:whichwaytomongolia.com, DNS:whidbeybicycleclub.org, DNS:whidbeycarenet.org, DNS:whidbeyfocus.com, DNS:whidbeyislandcarpentry.com, DNS:whidbeyislandelectricbikerentals.com, DNS:whidbeyislandgirl.net, DNS:whidbeyislandtreasurehunt.com, DNS:whidbeyislandyoga.com, DNS:whidbeymothermentors.org, DNS:whidbeystudents.com, DNS:whidbeywildlifehabitat.com, DNS:whiffofcordite.com, DNS:whifftestbuddysystem.com, DNS:while-here.com, DNS:while-you-were-sleeping.com, DNS:whileatoxford.com, DNS:whileatthezoo.com, DNS:whileawaytheday.com, DNS:whileawaythehoursblog.com, DNS:whiledarceysleeps.com, DNS:whileguide.com, DNS:whilehavingtea.com, DNS:whileiamthinkingaboutit.com, DNS:whileifelse.com, DNS:whileimwaitingblog.com, DNS:whileinaustralia.com, DNS:whileinheels.com, DNS:whileiwasreading.com, DNS:whilemaandpawsawaypetservices.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Wheyinonthecurds.com

Number of occurences: 8
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: application-name
    Content: Whey In On The Curd
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Whey In On The Curd on WordPress.com

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns2.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Tue, 31 May 2016 05:10:08 GMT Content-Type: text/html Content-Length: 178 Location: https://wheyinonthecurds.com/ X-ac: 3.bur _bur X-Cache: MISS from s_bd41 X-Cache-Lookup: MISS from s_bd41:80 Via: 1.1 s_bd41 (squid/3.5.19) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Tue, 31 May 2016 05:10:09 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.bur _bur

DNS

host: wheyinonthecurds.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: wheyinonthecurds.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: wheyinonthecurds.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: wheyinonthecurds.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: wheyinonthecurds.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: wheyinonthecurds.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.heyinonthecurds.com, www.w heyinonthecurds.com, www. heyinonthecurds.com, www.wcheyinonthecurds.com, www.cheyinonthecurds.com, www.wheyinonthecurds.com, www.heyinonthecurds.com, www.wdheyinonthecurds.com, www.dheyinonthecurds.com, www.wfheyinonthecurds.com, www.fheyinonthecurds.com, www.wgheyinonthecurds.com, www.gheyinonthecurds.com, www.wbheyinonthecurds.com, www.bheyinonthecurds.com, www.weyinonthecurds.com, www.wheeyinonthecurds.com, www.weeyinonthecurds.com, www.whdeyinonthecurds.com, www.wdeyinonthecurds.com, www.whceyinonthecurds.com, www.wceyinonthecurds.com, www.whueyinonthecurds.com, www.wueyinonthecurds.com, www.whjeyinonthecurds.com, www.wjeyinonthecurds.com, www.wheyinonthecurds.com, www.weyinonthecurds.com, www.whbeyinonthecurds.com, www.wbeyinonthecurds.com, www.whgeyinonthecurds.com, www.wgeyinonthecurds.com, www.whyinonthecurds.com, www.whexyinonthecurds.com, www.whxyinonthecurds.com, www.whesyinonthecurds.com, www.whsyinonthecurds.com, www.whewyinonthecurds.com, www.whwyinonthecurds.com, www.wheryinonthecurds.com, www.whryinonthecurds.com, www.whefyinonthecurds.com, www.whfyinonthecurds.com, www.whevyinonthecurds.com, www.whvyinonthecurds.com, www.whecyinonthecurds.com, www.whcyinonthecurds.com, www.wheqyinonthecurds.com, www.whqyinonthecurds.com, www.wheayinonthecurds.com, www.whayinonthecurds.com, www.wheyyinonthecurds.com, www.whyyinonthecurds.com, www.wheinonthecurds.com, www.wheyzinonthecurds.com, www.whezinonthecurds.com, www.wheyainonthecurds.com, www.wheainonthecurds.com, www.wheysinonthecurds.com, www.whesinonthecurds.com, www.wheydinonthecurds.com, www.whedinonthecurds.com, www.wheyinonthecurds.com, www.wheinonthecurds.com, www.wheycinonthecurds.com, www.whecinonthecurds.com, www.whey inonthecurds.com, www.whe inonthecurds.com, www.wheynonthecurds.com, www.wheyirnonthecurds.com, www.wheyrnonthecurds.com, www.wheyifnonthecurds.com, www.wheyfnonthecurds.com, www.wheyivnonthecurds.com, www.wheyvnonthecurds.com, www.wheyiknonthecurds.com, www.wheyknonthecurds.com, www.wheyi,nonthecurds.com, www.whey,nonthecurds.com, www.wheyibnonthecurds.com, www.wheybnonthecurds.com, www.wheyignonthecurds.com, www.wheygnonthecurds.com, www.wheyitnonthecurds.com, www.wheytnonthecurds.com, www.wheyiynonthecurds.com, www.wheyynonthecurds.com, www.wheyiunonthecurds.com, www.wheyunonthecurds.com, www.wheyijnonthecurds.com, www.wheyjnonthecurds.com, www.wheyimnonthecurds.com, www.wheymnonthecurds.com, www.wheyinnonthecurds.com, www.wheynnonthecurds.com, www.wheyionthecurds.com, www.wheyinnonthecurds.com, www.wheyinonthecurds.com, www.wheyinhonthecurds.com, www.wheyihonthecurds.com, www.wheyinjonthecurds.com, www.wheyijonthecurds.com, www.wheyinkonthecurds.com, www.wheyikonthecurds.com, www.wheyinlonthecurds.com, www.wheyilonthecurds.com, www.wheyin onthecurds.com, www.wheyi onthecurds.com, www.wheyinnthecurds.com, www.wheyinobnthecurds.com, www.wheyinbnthecurds.com, www.wheyinohnthecurds.com, www.wheyinhnthecurds.com, www.wheyinognthecurds.com, www.wheyingnthecurds.com, www.wheyinojnthecurds.com, www.wheyinjnthecurds.com, www.wheyinomnthecurds.com, www.wheyinmnthecurds.com, www.wheyino nthecurds.com, www.wheyin nthecurds.com, www.wheyinovnthecurds.com, www.wheyinvnthecurds.com, www.wheyinothecurds.com, www.wheyinonnthecurds.com, www.wheyinonthecurds.com, www.wheyinonhthecurds.com, www.wheyinohthecurds.com, www.wheyinonjthecurds.com, www.wheyinojthecurds.com, www.wheyinonkthecurds.com, www.wheyinokthecurds.com, www.wheyinonlthecurds.com, www.wheyinolthecurds.com, www.wheyinon thecurds.com, www.wheyino thecurds.com, www.wheyinonhecurds.com, www.wheyinontqhecurds.com, www.wheyinonqhecurds.com, www.wheyinontahecurds.com, www.wheyinonahecurds.com, www.wheyinont hecurds.com, www.wheyinon hecurds.com, www.wheyinontwhecurds.com, www.wheyinonwhecurds.com, www.wheyinontehecurds.com, www.wheyinonehecurds.com, www.wheyinontzhecurds.com, www.wheyinonzhecurds.com, www.wheyinontxhecurds.com, www.wheyinonxhecurds.com, www.wheyinontchecurds.com, www.wheyinonchecurds.com, www.wheyinontecurds.com, www.wheyinontheecurds.com, www.wheyinonteecurds.com, www.wheyinonthdecurds.com, www.wheyinontdecurds.com, www.wheyinonthcecurds.com, www.wheyinontcecurds.com, www.wheyinonthuecurds.com, www.wheyinontuecurds.com, www.wheyinonthjecurds.com, www.wheyinontjecurds.com, www.wheyinonthecurds.com, www.wheyinontecurds.com, www.wheyinonthbecurds.com, www.wheyinontbecurds.com, www.wheyinonthgecurds.com, www.wheyinontgecurds.com,

Other websites we recently analyzed

  1. Home · CrystalLightWorks · Online Store Powered by Storenvy
    Crystal Light works is Jewelry with Purpose and more. Meditation Pillows to Sterling Silver Pendants. Each crafted for their attributes more then esthetics. We are currently moving all product over from our old website. Please Envy us to stay tuned. - Online Store Powered by Storenvy
    Atlanta (United States) - 216.180.248.37
    Server software: Microsoft-IIS/7.5
    Technology: CloudFront, CSS, Html, Html5, Iframe, Javascript, PageSpeed Module, Google Analytics, New Relic
    Number of Javascript: 4
    Number of meta tags: 13
  2. Kapsułki na odchudzanie > Młody zielony jęczmień bio!
    Poland - 188.116.9.209
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, Yandex.Metrika
    Number of Javascript: 1
    Number of meta tags: 5
  3. SnoreBuster :: End Your Snoring and Sleep Well Through the Night
    Quit snoring and end the suffering! Amazing hypnosis program for the snorer -- and the 'listener'! By professional Certified Hypnotist.
    Houston (United States) - 192.185.41.244
    Server software: nginx/1.10.1
    Technology: CSS, Html, Javascript, Php, StatCounter
    Number of Javascript: 2
    Number of meta tags: 5
  4. .....CM Conceil...........................................................................................
    Provo (United States) - 67.20.107.75
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 1
  5. SCAT Happy Teams means Happy Customers! - Happy Customers means More PROFIT!
    Make sure your Leisure Park Team Members are the best they can be to maximize Your Profits with SCAT Training & Consultancy
    United Kingdom - 79.170.44.130
    Server software: Apache/2.4.18 (Unix)
    Technology: CSS, Html, Javascript, Swf Object, Google Analytics
    Number of Javascript: 1
    Number of meta tags: 6
  6. solarsystem.mobi is a Premium Name
    Ashburn (United States) - 54.225.105.179
    Server software: nginx/1.6.2
    Technology: CSS, Feedburner, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. Coffeyville Church of Christ | Coffeyville, KS
    Provo (United States) - 50.87.235.159
    Server software: nginx/1.10.1
    Technology: Html, Html5, jQuery, Php
    Number of Javascript: 4
    Number of meta tags: 2
  8. Wicked Yarns
    Suppliers of Promotional Merchandise & Clothing, Business Gifts & Incentives - promotional mugs, pens, balloons, banners, desktop items & keyrings etc
    Toronto (Canada) - 64.34.123.214
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 6
    Number of meta tags: 4
  9. referendum.nu
    Group (Netherlands) - 80.246.191.52
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  10. cardenfresno.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2

Check Other Websites